Lineage for d1fe8h2 (1fe8 H:116-216)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1760578Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1760894Species Mouse (Mus musculus) [TaxId:10090] [88576] (415 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 1761030Domain d1fe8h2: 1fe8 H:116-216 [59787]
    Other proteins in same PDB: d1fe8a_, d1fe8b_, d1fe8c_, d1fe8h1, d1fe8i1, d1fe8j1, d1fe8l1, d1fe8l2, d1fe8m1, d1fe8m2, d1fe8n1, d1fe8n2
    part of Fab RU5 inhibiting the collagen binding by the von willebrand factor a3 domain
    complexed with cac, nag

Details for d1fe8h2

PDB Entry: 1fe8 (more details), 2.03 Å

PDB Description: crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding
PDB Compounds: (H:) immunoglobulin igg ru5

SCOPe Domain Sequences for d1fe8h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fe8h2 b.1.1.2 (H:116-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
aettapsvyklepvssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
svtvtsstwpsqsitcnvahpasstkvdkkieprg

SCOPe Domain Coordinates for d1fe8h2:

Click to download the PDB-style file with coordinates for d1fe8h2.
(The format of our PDB-style files is described here.)

Timeline for d1fe8h2: