Lineage for d1fe8c_ (1fe8 C:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704292Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 704293Superfamily c.62.1: vWA-like [53300] (5 families) (S)
  5. 704294Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)
  6. 704398Protein von Willebrand factor A3 domain, vWA3 [53304] (1 species)
  7. 704399Species Human (Homo sapiens) [TaxId:9606] [53305] (4 PDB entries)
  8. 704407Domain d1fe8c_: 1fe8 C: [59785]
    Other proteins in same PDB: d1fe8h1, d1fe8h2, d1fe8i1, d1fe8i2, d1fe8j1, d1fe8j2, d1fe8l1, d1fe8l2, d1fe8m1, d1fe8m2, d1fe8n1, d1fe8n2
    complexed with cac, fuc, nag

Details for d1fe8c_

PDB Entry: 1fe8 (more details), 2.03 Å

PDB Description: crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding
PDB Compounds: (C:) von willebrand factor

SCOP Domain Sequences for d1fe8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fe8c_ c.62.1.1 (C:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]}
apdcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittid
vpwnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtd
vsvdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvt
lgnsflhklcs

SCOP Domain Coordinates for d1fe8c_:

Click to download the PDB-style file with coordinates for d1fe8c_.
(The format of our PDB-style files is described here.)

Timeline for d1fe8c_: