Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (6 families) |
Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins) |
Protein von Willebrand factor A3 domain, vWA3 [53304] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [53305] (3 PDB entries) |
Domain d1fe8b_: 1fe8 B: [59784] Other proteins in same PDB: d1fe8h1, d1fe8h2, d1fe8i1, d1fe8i2, d1fe8j1, d1fe8j2, d1fe8l1, d1fe8l2, d1fe8m1, d1fe8m2, d1fe8n1, d1fe8n2 complexed with cac, nag |
PDB Entry: 1fe8 (more details), 2.03 Å
SCOPe Domain Sequences for d1fe8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fe8b_ c.62.1.1 (B:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]} pdcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidv pwnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdv svdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtl gnsflhklcs
Timeline for d1fe8b_: