Lineage for d1fe8a_ (1fe8 A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 247390Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 247391Superfamily c.62.1: vWA-like [53300] (2 families) (S)
  5. 247392Family c.62.1.1: Integrin A (or I) domain [53301] (8 proteins)
  6. 247449Protein von Willebrand factor A3 domain, vWA3 [53304] (1 species)
  7. 247450Species Human (Homo sapiens) [TaxId:9606] [53305] (3 PDB entries)
  8. 247455Domain d1fe8a_: 1fe8 A: [59783]
    Other proteins in same PDB: d1fe8h1, d1fe8h2, d1fe8i1, d1fe8i2, d1fe8j1, d1fe8j2, d1fe8l1, d1fe8l2, d1fe8m1, d1fe8m2, d1fe8n1, d1fe8n2

Details for d1fe8a_

PDB Entry: 1fe8 (more details), 2.03 Å

PDB Description: crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding

SCOP Domain Sequences for d1fe8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fe8a_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens)}
pdcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidv
pwnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdv
svdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtl
gnsflhklcs

SCOP Domain Coordinates for d1fe8a_:

Click to download the PDB-style file with coordinates for d1fe8a_.
(The format of our PDB-style files is described here.)

Timeline for d1fe8a_: