Lineage for d1fe7b_ (1fe7 B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101410Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
  4. 101411Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 101416Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins)
  6. 101491Protein Snake phospholipase A2 [48624] (13 species)
  7. 101546Species Snake (Daboia russelli pulchella) [48630] (3 PDB entries)
  8. 101548Domain d1fe7b_: 1fe7 B: [59782]

Details for d1fe7b_

PDB Entry: 1fe7 (more details), 1.8 Å

PDB Description: first structural evidence of anti-inflammatory action of vitamin e (2,5,7,8-tetramethyl-2-(4',8',12'-trimethyltridecyl)-6-chromanol) through its binding to phospholipase a2 specifically: crystal structure of a complex formed between phospholipase a2 and vitamin e at 1.80 resolution

SCOP Domain Sequences for d1fe7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fe7b_ a.133.1.2 (B:) Snake phospholipase A2 {Snake (Daboia russelli pulchella)}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOP Domain Coordinates for d1fe7b_:

Click to download the PDB-style file with coordinates for d1fe7b_.
(The format of our PDB-style files is described here.)

Timeline for d1fe7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fe7a_