Lineage for d1fe7a_ (1fe7 A:)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins) 
Protein Snake phospholipase A2 [48624] (13 species) 
Species Snake (Daboia russelli pulchella) [48630] (3 PDB entries) 
Domain d1fe7a_: 1fe7 A: [59781]
Details for d1fe7a_
PDB Entry: 1fe7 (more details), 1.8 Å
PDB Description: first structural evidence of anti-inflammatory action of vitamin e (2,5,7,8-tetramethyl-2-(4',8',12'-trimethyltridecyl)-6-chromanol) through its binding to phospholipase a2 specifically: crystal structure of a complex formed between phospholipase a2 and vitamin e at 1.80 resolution
SCOP Domain Sequences for d1fe7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fe7a_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russelli pulchella)}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c
SCOP Domain Coordinates for d1fe7a_:
Click to download the PDB-style file with coordinates for d1fe7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fe7a_:
- d1fe7a_ first appeared in SCOP 1.57
- d1fe7a_ does not appear in SCOP 1.61
View in 3D
