Lineage for d1fd9a_ (1fd9 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548394Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2548395Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2548534Protein Macrophage infectivity potentiator protein (MIP) [64250] (2 species)
    contains all-alpha dimerisation subdomain in the N-terminal extension
  7. 2548535Species Legionella pneumophila [TaxId:446] [64251] (1 PDB entry)
  8. 2548536Domain d1fd9a_: 1fd9 A: [59771]
    complexed with zn

Details for d1fd9a_

PDB Entry: 1fd9 (more details), 2.41 Å

PDB Description: crystal structure of the macrophage infectivity potentiator protein (mip) a major virulence factor from legionella pneumophila
PDB Compounds: (A:) protein (macrophage infectivity potentiator protein)

SCOPe Domain Sequences for d1fd9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]}
tdkdklsysigadlgknfknqgidvnpeamakgmqdamsgaqlalteqqmkdvlnkfqkd
lmakrtaefnkkadenkvkgeafltenknkpgvvvlpsglqykvinsgngvkpgksdtvt
veytgrlidgtvfdstektgkpatfqvsqvipgwtealqlmpagstweiyvpsglaygpr
svggpigpnetlifkihlisvkks

SCOPe Domain Coordinates for d1fd9a_:

Click to download the PDB-style file with coordinates for d1fd9a_.
(The format of our PDB-style files is described here.)

Timeline for d1fd9a_: