![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
![]() | Protein Macrophage infectivity potentiator protein (MIP) [64250] (2 species) contains all-alpha dimerisation subdomain in the N-terminal extension |
![]() | Species Legionella pneumophila [TaxId:446] [64251] (1 PDB entry) |
![]() | Domain d1fd9a_: 1fd9 A: [59771] complexed with zn |
PDB Entry: 1fd9 (more details), 2.41 Å
SCOPe Domain Sequences for d1fd9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} tdkdklsysigadlgknfknqgidvnpeamakgmqdamsgaqlalteqqmkdvlnkfqkd lmakrtaefnkkadenkvkgeafltenknkpgvvvlpsglqykvinsgngvkpgksdtvt veytgrlidgtvfdstektgkpatfqvsqvipgwtealqlmpagstweiyvpsglaygpr svggpigpnetlifkihlisvkks
Timeline for d1fd9a_: