Lineage for d1fcla_ (1fcl A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77788Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 78181Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 78182Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 78192Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)
  7. 78193Species Streptococcus sp., group G [TaxId:1306] [54361] (16 PDB entries)
  8. 78202Domain d1fcla_: 1fcl A: [59768]

Details for d1fcla_

PDB Entry: 1fcl (more details)

PDB Description: delta1.5: a computationally designed core variant of the b1 domain of streptococcal protein g

SCOP Domain Sequences for d1fcla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcla_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G}
ttfkliingktlkgettteavdaataekvlkqyindngidgewtyddatktwtvte

SCOP Domain Coordinates for d1fcla_:

Click to download the PDB-style file with coordinates for d1fcla_.
(The format of our PDB-style files is described here.)

Timeline for d1fcla_: