SCOPe 2.07: Domain d1f9xa1: 1f9x A:241-356

Lineage for d1f9xa1 (1f9x A:241-356)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein BIR domains of XIAP [57928] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57929] (15 PDB entries)
   Uniprot P98170 241-356

8. Domain d1f9xa1: 1f9x A:241-356 [59748]
   Other proteins in same PDB: d1f9xa2
   BIR3 domain
   complexed with zn

Details for d1f9xa1

PDB Entry: 1f9x

PDB Description: average nmr solution structure of the bir-3 domain of xiap

PDB Compounds: (A:) inhibitor of apoptosis protein xiap

SCOPe Domain Sequences for d1f9xa1:

Sequence; same for both SEQRES and ATOM records:

>d1f9xa1 g.52.1.1 (A:241-356) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
sdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkc
fhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt

Timeline for d1f9xa1:

• d1f9xa1 first appeared in SCOP 1.57, called d1f9xa_
  
• d1f9xa1 appears in SCOPe 2.06
  
• d1f9xa1 appears in the current release, SCOPe 2.08