Lineage for d1f9ga2 (1f9g A:815-890)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777794Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 2777795Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (2 families) (S)
  5. 2777796Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 2777814Protein Hyaluronate lyase [49867] (2 species)
  7. 2777815Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [49868] (18 PDB entries)
    Uniprot Q54873 287-1007
  8. 2777829Domain d1f9ga2: 1f9g A:815-890 [59739]
    Other proteins in same PDB: d1f9ga1, d1f9ga3
    complexed with asc

Details for d1f9ga2

PDB Entry: 1f9g (more details), 2 Å

PDB Description: crystal structure of streptococcus pneumoniae hyaluronate lyase cocrystallized with ascorbic acid
PDB Compounds: (A:) hyaluronate lyase

SCOPe Domain Sequences for d1f9ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9ga2 b.24.1.1 (A:815-890) Hyaluronate lyase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
ssliennetlqsvydakqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayyn
petqesapdqevfkkl

SCOPe Domain Coordinates for d1f9ga2:

Click to download the PDB-style file with coordinates for d1f9ga2.
(The format of our PDB-style files is described here.)

Timeline for d1f9ga2: