Lineage for d1f9e.6 (1f9e K:,L:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825082Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 825083Superfamily c.17.1: Caspase-like [52129] (2 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 825084Family c.17.1.1: Caspase catalytic domain [52130] (7 proteins)
  6. 825154Protein Caspase-8 [52135] (1 species)
  7. 825155Species Human (Homo sapiens) [TaxId:9606] [52136] (5 PDB entries)
  8. 825162Domain d1f9e.6: 1f9e K:,L: [59737]
    complexed with phq

Details for d1f9e.6

PDB Entry: 1f9e (more details), 2.9 Å

PDB Description: caspase-8 specificity probed at subsite s4: crystal structure of the caspase-8-z-devd-cho
PDB Compounds: (K:) caspase-8 alpha chain, (L:) caspase-8 beta chain

SCOP Domain Sequences for d1f9e.6:

Sequence; same for both SEQRES and ATOM records: (download)

>g1f9e.6 c.17.1.1 (K:,L:) Caspase-8 {Human (Homo sapiens) [TaxId: 9606]}
ldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfei
kphhdctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqft
glkcpslagkpkvffiqacqgdnyqkgipvetdXtryipdeadfllgmatvnncvsyrnp
aegtwyiqslcqslrercprgddiltiltevnyevsnkddkknmgkqmpqptftlrkklv
fps

SCOP Domain Coordinates for d1f9e.6:

Click to download the PDB-style file with coordinates for d1f9e.6.
(The format of our PDB-style files is described here.)

Timeline for d1f9e.6: