SCOPe 2.08: Domain d1f9e.1: 1f9e A:,B:

Lineage for d1f9e.1 (1f9e A:,B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.17: Caspase-like [52128] (1 superfamily)
   3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest

4. Superfamily c.17.1: Caspase-like [52129] (3 families)
   mature protein may be composed of two chains folded in a single domain

5. Family c.17.1.1: Caspase catalytic domain [52130] (8 proteins)

6. Protein Caspase-8 [52135] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52136] (8 PDB entries)

8. Domain d1f9e.1: 1f9e A:,B: [59732]

Details for d1f9e.1

PDB Entry: 1f9e, 2.9 Å

PDB Description: caspase-8 specificity probed at subsite s4: crystal structure of the caspase-8-z-devd-cho

PDB Compounds: (A:) caspase-8 alpha chain, (B:) caspase-8 beta chain

SCOPe Domain Sequences for d1f9e.1:

Sequence; same for both SEQRES and ATOM records:

>g1f9e.1 c.17.1.1 (A:,B:) Caspase-8 {Human (Homo sapiens) [TaxId: 9606]}
ldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfei
kphhdctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqft
glkcpslagkpkvffiqacqgdnyqkgipvetdXtryipdeadfllgmatvnncvsyrnp
aegtwyiqslcqslrercprgddiltiltevnyevsnkddkknmgkqmpqptftlrkklv
fps

Timeline for d1f9e.1:

• d1f9e.1 first appeared in SCOP 1.57
  
• d1f9e.1 appears in SCOPe 2.07