Lineage for d1f99n_ (1f99 N:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 759877Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 759956Protein Phycocyanin beta subunit [88940] (6 species)
  7. 759962Species Red alga (Polysiphonia urceolata) [TaxId:65404] [88942] (1 PDB entry)
  8. 759965Domain d1f99n_: 1f99 N: [59727]
    Other proteins in same PDB: d1f99a_, d1f99k_, d1f99m_
    complexed with cyc, peb

Details for d1f99n_

PDB Entry: 1f99 (more details), 2.4 Å

PDB Description: crystal structure of r-phycocyanin from polysiphonia at 2.4 a resolution
PDB Compounds: (N:) r-phycocyanin

SCOP Domain Sequences for d1f99n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f99n_ a.1.1.3 (N:) Phycocyanin beta subunit {Red alga (Polysiphonia urceolata) [TaxId: 65404]}
mldafakvvaqadargeflsntqidallaivsegnkrldvvnkitnnasaivtnaaralf
aeqpqlispggnaytsrrmaaclrdmeivlryvsyamiagdasvlddrclnglretyqal
gtpgasvavaiqkmkdaalalvndttgtpagdcaslvaeiatyfdraaaava

SCOP Domain Coordinates for d1f99n_:

Click to download the PDB-style file with coordinates for d1f99n_.
(The format of our PDB-style files is described here.)

Timeline for d1f99n_: