SCOP 1.75: Domain d1f99l_: 1f99 L:

Lineage for d1f99l_ (1f99 L:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein Phycocyanin beta subunit [88940] (6 species)

7. Species Red alga (Polysiphonia urceolata) [TaxId:65404] [88942] (1 PDB entry)

8. Domain d1f99l_: 1f99 L: [59725]
   Other proteins in same PDB: d1f99a_, d1f99k_, d1f99m_

Details for d1f99l_

PDB Entry: 1f99, 2.4 Å

PDB Description: crystal structure of r-phycocyanin from polysiphonia at 2.4 a resolution

PDB Compounds: (L:) r-phycocyanin

SCOP Domain Sequences for d1f99l_:

Sequence; same for both SEQRES and ATOM records:

>d1f99l_ a.1.1.3 (L:) Phycocyanin beta subunit {Red alga (Polysiphonia urceolata) [TaxId: 65404]}
mldafakvvaqadargeflsntqidallaivsegnkrldvvnkitnnasaivtnaaralf
aeqpqlispggnaytsrrmaaclrdmeivlryvsyamiagdasvlddrclnglretyqal
gtpgasvavaiqkmkdaalalvndttgtpagdcaslvaeiatyfdraaaava

Timeline for d1f99l_:

• d1f99l_ first appeared in SCOP 1.57
  
• d1f99l_ appears in SCOP 1.73
  
• d1f99l_ appears in SCOPe 2.01
  
• d1f99l_ appears in the current release, SCOPe 2.08