Lineage for d1f99b_ (1f99 B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 531798Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 531864Protein Phycocyanin beta subunit [88940] (6 species)
  7. 531870Species Red alga (Polysiphonia urceolata) [TaxId:65404] [88942] (1 PDB entry)
  8. 531871Domain d1f99b_: 1f99 B: [59723]
    Other proteins in same PDB: d1f99a_, d1f99k_, d1f99m_

Details for d1f99b_

PDB Entry: 1f99 (more details), 2.4 Å

PDB Description: crystal structure of r-phycocyanin from polysiphonia at 2.4 a resolution

SCOP Domain Sequences for d1f99b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f99b_ a.1.1.3 (B:) Phycocyanin beta subunit {Red alga (Polysiphonia urceolata)}
mldafakvvaqadargeflsntqidallaivsegnkrldvvnkitnnasaivtnaaralf
aeqpqlispggnaytsrrmaaclrdmeivlryvsyamiagdasvlddrclnglretyqal
gtpgasvavaiqkmkdaalalvndttgtpagdcaslvaeiatyfdraaaava

SCOP Domain Coordinates for d1f99b_:

Click to download the PDB-style file with coordinates for d1f99b_.
(The format of our PDB-style files is described here.)

Timeline for d1f99b_: