SCOPe 2.08: Domain d1f91a2: 1f91 A:254-406

Lineage for d1f91a2 (1f91 A:254-406)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Beta-ketoacyl-ACP synthase I, C-terminal domain [419015] (2 species)

7. Species Escherichia coli [TaxId:562] [419487] (19 PDB entries)
   Uniprot P14926

8. Domain d1f91a2: 1f91 A:254-406 [59714]
   Other proteins in same PDB: d1f91a1, d1f91b1, d1f91c1, d1f91d1
   complexed with dka, oh

Details for d1f91a2

PDB Entry: 1f91, 2.4 Å

PDB Description: beta-ketoacyl-[acyl-carrier-protein] synthase i in complex with c10 fatty acid substrate

PDB Compounds: (A:) beta-ketoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d1f91a2:

Sequence; same for both SEQRES and ATOM records:

>d1f91a2 c.95.1.1 (A:254-406) Beta-ketoacyl-ACP synthase I, C-terminal domain {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

Timeline for d1f91a2:

• d1f91a2 first appeared in SCOP 1.57
  
• d1f91a2 appears in SCOPe 2.07