Lineage for d1f90h2 (1f90 H:114-230)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365019Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 365143Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)
  8. 365302Domain d1f90h2: 1f90 H:114-230 [59710]
    Other proteins in same PDB: d1f90h1, d1f90l1, d1f90l2
    part of anti-IL2 Fab LNKB-2

Details for d1f90h2

PDB Entry: 1f90 (more details), 2.6 Å

PDB Description: fab fragment of monoclonal antibody (lnkb-2) against human interleukin-2 in complex with antigenic peptide

SCOP Domain Sequences for d1f90h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f90h2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1f90h2:

Click to download the PDB-style file with coordinates for d1f90h2.
(The format of our PDB-style files is described here.)

Timeline for d1f90h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f90h1