Lineage for d1f90h2 (1f90 H:114-230)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 103740Species Anti-IL2 Fab LNKB-2, (mouse), kappa L chain [63655] (2 PDB entries)
  8. 103743Domain d1f90h2: 1f90 H:114-230 [59710]
    Other proteins in same PDB: d1f90h1, d1f90l1

Details for d1f90h2

PDB Entry: 1f90 (more details), 2.6 Å

PDB Description: fab fragment of monoclonal antibody (lnkb-2) against human interleukin-2 in complex with antigenic peptide

SCOP Domain Sequences for d1f90h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f90h2 b.1.1.2 (H:114-230) Immunoglobulin (constant domains of L and H chains) {Anti-IL2 Fab LNKB-2, (mouse), kappa L chain}
akttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1f90h2:

Click to download the PDB-style file with coordinates for d1f90h2.
(The format of our PDB-style files is described here.)

Timeline for d1f90h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f90h1