Lineage for d1f90h1 (1f90 H:1-113)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021582Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2022436Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (39 PDB entries)
    Uniprot P18532 # HV61_MOUSE Ig heavy chain V region 1B43 precursor
  8. 2022453Domain d1f90h1: 1f90 H:1-113 [59709]
    Other proteins in same PDB: d1f90h2, d1f90l1, d1f90l2
    part of anti-IL2 Fab LNKB-2

Details for d1f90h1

PDB Entry: 1f90 (more details), 2.6 Å

PDB Description: fab fragment of monoclonal antibody (lnkb-2) against human interleukin-2 in complex with antigenic peptide
PDB Compounds: (H:) fab fragment of monoclonal antibody

SCOPe Domain Sequences for d1f90h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f90h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]}
gvqlqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyitysgstgy
npslksrisitrdtsknqfflqlnsvttedtatyycasyddytwftywgqgtlvtvsa

SCOPe Domain Coordinates for d1f90h1:

Click to download the PDB-style file with coordinates for d1f90h1.
(The format of our PDB-style files is described here.)

Timeline for d1f90h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f90h2