SCOP 1.57: Domain d1f8th2: 1f8t H:114-230

Lineage for d1f8th2 (1f8t H:114-230)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Anti-IL2 Fab LNKB-2, (mouse), kappa L chain [63655] (2 PDB entries)

8. Domain d1f8th2: 1f8t H:114-230 [59706]
   Other proteins in same PDB: d1f8th1, d1f8tl1

Details for d1f8th2

PDB Entry: 1f8t, 2.2 Å

PDB Description: fab (lnkb-2) of monoclonal antibody, crystal structure

SCOP Domain Sequences for d1f8th2:

Sequence; same for both SEQRES and ATOM records:

>d1f8th2 b.1.1.2 (H:114-230) Immunoglobulin (constant domains of L and H chains) {Anti-IL2 Fab LNKB-2, (mouse), kappa L chain}
akttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

Timeline for d1f8th2:

• d1f8th2 is new in SCOP 1.57
  
• d1f8th2 appears in SCOP 1.59
  
• d1f8th2 appears in the current release, SCOPe 2.08