Lineage for d1f8th2 (1f8t H:114-230)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53309Species Anti-IL2 Fab LNKB-2, (mouse), kappa L chain [63655] (2 PDB entries)
  8. 53310Domain d1f8th2: 1f8t H:114-230 [59706]
    Other proteins in same PDB: d1f8th1, d1f8tl1

Details for d1f8th2

PDB Entry: 1f8t (more details), 2.2 Å

PDB Description: fab (lnkb-2) of monoclonal antibody, crystal structure

SCOP Domain Sequences for d1f8th2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f8th2 b.1.1.2 (H:114-230) Immunoglobulin (constant domains of L and H chains) {Anti-IL2 Fab LNKB-2, (mouse), kappa L chain}
akttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1f8th2:

Click to download the PDB-style file with coordinates for d1f8th2.
(The format of our PDB-style files is described here.)

Timeline for d1f8th2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f8th1