Lineage for d1f8th1 (1f8t H:1-113)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511275Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (39 PDB entries)
    Uniprot P18532 # HV61_MOUSE Ig heavy chain V region 1B43 precursor
  8. 1511285Domain d1f8th1: 1f8t H:1-113 [59705]
    Other proteins in same PDB: d1f8th2, d1f8tl1, d1f8tl2
    part of anti-IL2 Fab LNKB-2

Details for d1f8th1

PDB Entry: 1f8t (more details), 2.2 Å

PDB Description: fab (lnkb-2) of monoclonal antibody, crystal structure
PDB Compounds: (H:) antibody fab fragment (heavy chain)

SCOPe Domain Sequences for d1f8th1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f8th1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]}
gvqlqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyitysgstgy
npslksrisitrdtsknqfflqlnsvttedtatyycasyddytwftywgqgtlvtvsa

SCOPe Domain Coordinates for d1f8th1:

Click to download the PDB-style file with coordinates for d1f8th1.
(The format of our PDB-style files is described here.)

Timeline for d1f8th1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f8th2