Lineage for d1f8th1 (1f8t H:1-113)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102112Species Anti-IL2 Fab LNKB-2, (mouse), kappa L chain [63643] (2 PDB entries)
  8. 102113Domain d1f8th1: 1f8t H:1-113 [59705]
    Other proteins in same PDB: d1f8th2, d1f8tl2

Details for d1f8th1

PDB Entry: 1f8t (more details), 2.2 Å

PDB Description: fab (lnkb-2) of monoclonal antibody, crystal structure

SCOP Domain Sequences for d1f8th1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f8th1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-IL2 Fab LNKB-2, (mouse), kappa L chain}
gvqlqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyitysgstgy
npslksrisitrdtsknqfflqlnsvttedtatyycasyddytwftywgqgtlvtvsa

SCOP Domain Coordinates for d1f8th1:

Click to download the PDB-style file with coordinates for d1f8th1.
(The format of our PDB-style files is described here.)

Timeline for d1f8th1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f8th2