SCOP 1.57: Domain d1f8th1: 1f8t H:1-113

Lineage for d1f8th1 (1f8t H:1-113)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Anti-IL2 Fab LNKB-2, (mouse), kappa L chain [63643] (2 PDB entries)

8. Domain d1f8th1: 1f8t H:1-113 [59705]
   Other proteins in same PDB: d1f8th2, d1f8tl2

Details for d1f8th1

PDB Entry: 1f8t, 2.2 Å

PDB Description: fab (lnkb-2) of monoclonal antibody, crystal structure

SCOP Domain Sequences for d1f8th1:

Sequence; same for both SEQRES and ATOM records:

>d1f8th1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-IL2 Fab LNKB-2, (mouse), kappa L chain}
gvqlqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyitysgstgy
npslksrisitrdtsknqfflqlnsvttedtatyycasyddytwftywgqgtlvtvsa

Timeline for d1f8th1:

• d1f8th1 is new in SCOP 1.57
  
• d1f8th1 appears in SCOP 1.59
  
• d1f8th1 appears in the current release, SCOPe 2.08