Lineage for d1f8ca_ (1f8c A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
consists of six 4-stranded beta-sheet motifs; meander
Superfamily b.68.1: Sialidases [50939] (3 families) 
Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) 
Protein Influenza neuraminidase [50943] (9 species) Species Influenza A virus, different strains [TaxId:11320] [50944] (89 PDB entries)
Uniprot P03472 84-470
Domain d1f8ca_: 1f8c A: [59692]
complexed with 4am, ca, nag
Details for d1f8ca_
PDB Entry: 1f8c (more details), 1.7 Å
PDB Description: native influenza neuraminidase in complex with 4-amino-2-deoxy-2,3- dehydro-n-neuraminic acid
PDB Compounds: (A:) NeuraminidaseSCOPe Domain Sequences for d1f8ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f8ca_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwdwpdgakieyfl
SCOPe Domain Coordinates for d1f8ca_:
Click to download the PDB-style file with coordinates for d1f8ca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f8ca_:
- d1f8ca_ first appeared in SCOP 1.57
- d1f8ca_ appears in SCOPe 2.07
View in 3D