SCOPe 2.03: Domain d1f7za_: 1f7z A:

Lineage for d1f7za_ (1f7z A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (36 PDB entries)

8. Domain d1f7za_: 1f7z A: [59681]
   Other proteins in same PDB: d1f7zi_
   complexed with ca, so4

Details for d1f7za_

PDB Entry: 1f7z, 1.55 Å

PDB Description: rat trypsinogen k15a complexed with bovine pancreatic trypsin inhibitor

PDB Compounds: (A:) trypsin II, anionic

SCOPe Domain Sequences for d1f7za_:

Sequence, based on SEQRES records:

>d1f7za_ b.47.1.2 (A:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Sequence, based on observed residues (ATOM records):

>d1f7za_ b.47.1.2 (A:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggpvvcngelqgi
vswgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d1f7za_:

• d1f7za_ first appeared in SCOP 1.57
  
• d1f7za_ appears in SCOPe 2.02
  
• d1f7za_ appears in SCOPe 2.04
  
• d1f7za_ appears in the current release, SCOPe 2.08