Lineage for d1f7ta1 (1f7t A:2-119)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594189Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 2594190Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 2594200Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein)
    forms trimers with three closely packed beta-sheets similar to the IspF trimers
    automatically mapped to Pfam PF01648
  6. 2594201Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species)
  7. 2594202Species Bacillus subtilis [TaxId:1423] [64420] (3 PDB entries)
  8. 2594204Domain d1f7ta1: 1f7t A:2-119 [59667]
    Other proteins in same PDB: d1f7ta2, d1f7tb2, d1f7tc2, d1f7td2, d1f7te2, d1f7tf2
    complexed with cl, dtt, gol, na

Details for d1f7ta1

PDB Entry: 1f7t (more details), 1.8 Å

PDB Description: holo-(acyl carrier protein) synthase at 1.8a
PDB Compounds: (A:) holo-(acyl carrier protein) synthase

SCOPe Domain Sequences for d1f7ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7ta1 d.150.1.2 (A:2-119) Holo-(acyl carrier protein) synthase ACPS {Bacillus subtilis [TaxId: 1423]}
iygiglditelkriasmagrqkrfaeriltrseldqyyelsekrkneflagrfaakeafs
kafgtgigrqlsfqdieirkdqngkpyiictklspaavhvsithtkeyaaaqvvierl

SCOPe Domain Coordinates for d1f7ta1:

Click to download the PDB-style file with coordinates for d1f7ta1.
(The format of our PDB-style files is described here.)

Timeline for d1f7ta1: