SCOP 1.61: Domain d1f6nm1: 1f6n M:

Lineage for d1f6nm1 (1f6n M:)

1. Root: SCOP 1.61

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (13 families)

5. Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)

6. Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [56881] (28 PDB entries)

8. Domain d1f6nm1: 1f6n M: [59661]
   Other proteins in same PDB: d1f6nh1

Details for d1f6nm1

PDB Entry: 1f6n, 2.8 Å

PDB Description: crystal structure analysis of the mutant reaction center pro l209-> tyr from the photosynthetic purple bacterium rhodobacter sphaeroides

SCOP Domain Sequences for d1f6nm1:

Sequence; same for both SEQRES and ATOM records:

>d1f6nm1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodobacter sphaeroides}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d1f6nm1:

• d1f6nm1 first appeared in SCOP 1.57
  
• d1f6nm1 appears in SCOP 1.59
  
• d1f6nm1 is called d1f6nm_ in SCOP 1.63
  
• d1f6nm1 appears in the current release, SCOPe 2.08, called d1f6nm_