Lineage for d1f6nl_ (1f6n L:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1958788Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1958789Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1958790Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1958791Protein L (light) subunit [81477] (3 species)
  7. 1958792Species Rhodobacter sphaeroides [TaxId:1063] [81475] (61 PDB entries)
    Uniprot P02954
  8. 1958840Domain d1f6nl_: 1f6n L: [59660]
    Other proteins in same PDB: d1f6nh1, d1f6nh2, d1f6nm_
    complexed with bcl, bph, fe, lda, po4, spo, u10; mutant

Details for d1f6nl_

PDB Entry: 1f6n (more details), 2.8 Å

PDB Description: crystal structure analysis of the mutant reaction center pro l209-> tyr from the photosynthetic purple bacterium rhodobacter sphaeroides
PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d1f6nl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6nl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtydhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d1f6nl_:

Click to download the PDB-style file with coordinates for d1f6nl_.
(The format of our PDB-style files is described here.)

Timeline for d1f6nl_: