Lineage for d1f6nh1 (1f6n H:36-250)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167245Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
  4. 167246Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) (S)
  5. 167247Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 167248Protein Photosynthetic reaction centre [50348] (3 species)
  7. 167249Species Rhodobacter sphaeroides [TaxId:1063] [50350] (28 PDB entries)
  8. 167272Domain d1f6nh1: 1f6n H:36-250 [59658]
    Other proteins in same PDB: d1f6nh2, d1f6nl1, d1f6nm1

Details for d1f6nh1

PDB Entry: 1f6n (more details), 2.8 Å

PDB Description: crystal structure analysis of the mutant reaction center pro l209-> tyr from the photosynthetic purple bacterium rhodobacter sphaeroides

SCOP Domain Sequences for d1f6nh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6nh1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

SCOP Domain Coordinates for d1f6nh1:

Click to download the PDB-style file with coordinates for d1f6nh1.
(The format of our PDB-style files is described here.)

Timeline for d1f6nh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f6nh2