Lineage for d1f4la1 (1f4l A:389-548)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96910Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
  4. 96911Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) (S)
  5. 96912Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (4 proteins)
  6. 96929Protein Methionyl-tRNA synthetase (MetRS) [47325] (2 species)
  7. 96930Species Escherichia coli [TaxId:562] [47327] (2 PDB entries)
  8. 96931Domain d1f4la1: 1f4l A:389-548 [59648]
    Other proteins in same PDB: d1f4la2, d1f4la3

Details for d1f4la1

PDB Entry: 1f4l (more details), 1.85 Å

PDB Description: crystal structure of the e.coli methionyl-trna synthetase complexed with methionine

SCOP Domain Sequences for d1f4la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4la1 a.27.1.1 (A:389-548) Methionyl-tRNA synthetase (MetRS) {Escherichia coli}
vvnlasrnagfinkrfdgvlaseladpqlyktftdaaevigeawesrefgkavreimala
dlanryvdeqapwvvakqegrdadlqaicsmginlfrvlmtylkpvlpklteraeaflnt
eltwdgiqqpllghkvnpfkalynridmrqvealveaske

SCOP Domain Coordinates for d1f4la1:

Click to download the PDB-style file with coordinates for d1f4la1.
(The format of our PDB-style files is described here.)

Timeline for d1f4la1: