Lineage for d1f4kb_ (1f4k B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351617Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) (S)
    contains a small beta-sheet (wing)
  5. 351703Family a.4.5.7: Replication terminator protein (RTP) [46807] (1 protein)
  6. 351704Protein Replication terminator protein (RTP) [46808] (1 species)
    contains long helix in the C-terminal extension; forms dimer similar to the LysR-like dimer
  7. 351705Species Bacillus subtilis [TaxId:1423] [46809] (3 PDB entries)
  8. 351709Domain d1f4kb_: 1f4k B: [59647]
    complexed with DNA
    mutant

Details for d1f4kb_

PDB Entry: 1f4k (more details), 2.5 Å

PDB Description: crystal structure of the replication terminator protein/b-site dna complex

SCOP Domain Sequences for d1f4kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4kb_ a.4.5.7 (B:) Replication terminator protein (RTP) {Bacillus subtilis}
stgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslhelldd
gilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsdnf

SCOP Domain Coordinates for d1f4kb_:

Click to download the PDB-style file with coordinates for d1f4kb_.
(The format of our PDB-style files is described here.)

Timeline for d1f4kb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f4ka_