Lineage for d1f2oa_ (1f2o A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2497307Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2497538Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)
  6. 2497549Protein Aminopeptidase [53205] (2 species)
  7. 2497568Species Streptomyces griseus [TaxId:1911] [53207] (5 PDB entries)
  8. 2497571Domain d1f2oa_: 1f2o A: [59625]
    complexed with ca, leu, zn

Details for d1f2oa_

PDB Entry: 1f2o (more details), 1.7 Å

PDB Description: crystal structure of the streptomyces griseus aminopeptidase complexed with l-leucine
PDB Compounds: (A:) aminopeptidase

SCOPe Domain Sequences for d1f2oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2oa_ c.56.5.4 (A:) Aminopeptidase {Streptomyces griseus [TaxId: 1911]}
apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdmigspnpgyfvydddpviek
tfknyfaglnvpteietegdgrsdhapfknvgvpvgglftgagytksaaqaqkwggtagq
afdrcyhsscdslsnindtaldrnsdaaahaiwtlss

SCOPe Domain Coordinates for d1f2oa_:

Click to download the PDB-style file with coordinates for d1f2oa_.
(The format of our PDB-style files is described here.)

Timeline for d1f2oa_: