Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (17 proteins) |
Protein Aminopeptidase [53205] (2 species) |
Species Streptomyces griseus [TaxId:1911] [53207] (11 PDB entries) |
Domain d1f2oa_: 1f2o A: [59625] complexed with ca, leu, zn |
PDB Entry: 1f2o (more details), 1.7 Å
SCOP Domain Sequences for d1f2oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f2oa_ c.56.5.4 (A:) Aminopeptidase {Streptomyces griseus [TaxId: 1911]} apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdmigspnpgyfvydddpviek tfknyfaglnvpteietegdgrsdhapfknvgvpvgglftgagytksaaqaqkwggtagq afdrcyhsscdslsnindtaldrnsdaaahaiwtlss
Timeline for d1f2oa_: