SCOP 1.75: Domain d1f1hh2: 1f1h H:101-468

Lineage for d1f1hh2 (1f1h H:101-468)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (5 families)

5. Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (1 protein)

6. Protein Glutamine synthetase, C-terminal domain [55933] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [55934] (6 PDB entries)

8. Domain d1f1hh2: 1f1h H:101-468 [59587]
   Other proteins in same PDB: d1f1ha1, d1f1hb1, d1f1hc1, d1f1hd1, d1f1he1, d1f1hf1, d1f1hg1, d1f1hh1, d1f1hi1, d1f1hj1, d1f1hk1, d1f1hl1

Details for d1f1hh2

PDB Entry: 1f1h, 2.67 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium with thallium ions

PDB Compounds: (H:) protein (glutamine synthetase)

SCOP Domain Sequences for d1f1hh2:

Sequence; same for both SEQRES and ATOM records:

>d1f1hh2 d.128.1.1 (H:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns
stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne
vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn
lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvpgyeapvmlaysarnrs
asiripvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdknlydlp
peeakeipqvagsleealnaldldreflkaggvftdeaidayialrreeddrvrmtphpv
efelyysv

Timeline for d1f1hh2:

• d1f1hh2 first appeared in SCOP 1.57
  
• d1f1hh2 appears in SCOP 1.73
  
• d1f1hh2 appears in SCOPe 2.01
  
• d1f1hh2 appears in the current release, SCOPe 2.08