Lineage for d1f1cb_ (1f1c B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904708Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 904709Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 904710Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 905012Protein Photosystem II associated cytochrome c549 [63459] (2 species)
  7. 905013Species Arthrospira maxima [TaxId:129910] [63461] (1 PDB entry)
  8. 905015Domain d1f1cb_: 1f1c B: [59570]
    complexed with hem

Details for d1f1cb_

PDB Entry: 1f1c (more details), 2.3 Å

PDB Description: crystal structure of cytochrome c549
PDB Compounds: (B:) cytochrome c549

SCOPe Domain Sequences for d1f1cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1cb_ a.3.1.1 (B:) Photosystem II associated cytochrome c549 {Arthrospira maxima [TaxId: 129910]}
lteelrtfpinaqgdtavlslkeikkgqqvfnaacaqchalgvtrtnpdvnlspealala
tpprdniaalvdyiknpttydgfveiselhpslkssdifpkmrniseddlynvagyillq
pkvrgeqwg

SCOPe Domain Coordinates for d1f1cb_:

Click to download the PDB-style file with coordinates for d1f1cb_.
(The format of our PDB-style files is described here.)

Timeline for d1f1cb_: