Lineage for d1f1ca_ (1f1c A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 209874Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 209875Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 209876Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)
  6. 210107Protein Photosystem II associated cytochrome c549 [63459] (2 species)
  7. 210108Species Arthrospira maxima [TaxId:129910] [63461] (1 PDB entry)
  8. 210109Domain d1f1ca_: 1f1c A: [59569]

Details for d1f1ca_

PDB Entry: 1f1c (more details), 2.3 Å

PDB Description: crystal structure of cytochrome c549

SCOP Domain Sequences for d1f1ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1ca_ a.3.1.1 (A:) Photosystem II associated cytochrome c549 {Arthrospira maxima}
lteelrtfpinaqgdtavlslkeikkgqqvfnaacaqchalgvtrtnpdvnlspealala
tpprdniaalvdyiknpttydgfveiselhpslkssdifpkmrniseddlynvagyillq
pkvrgeqwg

SCOP Domain Coordinates for d1f1ca_:

Click to download the PDB-style file with coordinates for d1f1ca_.
(The format of our PDB-style files is described here.)

Timeline for d1f1ca_: