Lineage for d1f1ca_ (1f1c A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45013Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins)
  6. 45190Protein Photosystem II associated cytochrome c549 [63459] (2 species)
  7. 45191Species Arthrospira maxima [TaxId:129910] [63461] (1 PDB entry)
  8. 45192Domain d1f1ca_: 1f1c A: [59569]

Details for d1f1ca_

PDB Entry: 1f1c (more details), 2.3 Å

PDB Description: crystal structure of cytochrome c549

SCOP Domain Sequences for d1f1ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1ca_ a.3.1.1 (A:) Photosystem II associated cytochrome c549 {Arthrospira maxima}
lteelrtfpinaqgdtavlslkeikkgqqvfnaacaqchalgvtrtnpdvnlspealala
tpprdniaalvdyiknpttydgfveiselhpslkssdifpkmrniseddlynvagyillq
pkvrgeqwg

SCOP Domain Coordinates for d1f1ca_:

Click to download the PDB-style file with coordinates for d1f1ca_.
(The format of our PDB-style files is described here.)

Timeline for d1f1ca_: