Lineage for d1f0qa_ (1f0q A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84393Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 84394Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 84395Family d.144.1.1: Serine/threonin kinases [56113] (16 proteins)
  6. 84504Protein Protein kinase CK2, alpha subunit [56142] (1 species)
  7. 84505Species Maize (Zea mays) [TaxId:4577] [56143] (5 PDB entries)
  8. 84509Domain d1f0qa_: 1f0q A: [59568]

Details for d1f0qa_

PDB Entry: 1f0q (more details), 2.63 Å

PDB Description: crystal structure of the alpha subunit of protein kinase ck2 in complex with the nucleotide competitive inhibitor emodin

SCOP Domain Sequences for d1f0qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f0qa_ d.144.1.1 (A:) Protein kinase CK2, alpha subunit {Maize (Zea mays)}
mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
rydhqerltaleamthpyfqqvraaensr

SCOP Domain Coordinates for d1f0qa_:

Click to download the PDB-style file with coordinates for d1f0qa_.
(The format of our PDB-style files is described here.)

Timeline for d1f0qa_: