Lineage for d1ezvy_ (1ezv Y:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 783226Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (182 PDB entries)
    Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7
    SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region)
    SQ NA # humanized antibody
    SQ NA # part of Fab 28 against HIV-1 RT
    Uniprot P01642 21-115 #
    KV5I_MOUSE Ig kappa chain V-V region L7 precursor
    Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor
  8. 783340Domain d1ezvy_: 1ezv Y: [59555]
    Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvc2, d1ezvc3, d1ezvd1, d1ezvd2, d1ezve1, d1ezve2, d1ezvf_, d1ezvg_, d1ezvh_, d1ezvi_, d1ezvx_
    part of Fv against Rieske protein from the yeast cytochrome bc1 complex
    complexed with fes, hem, sma, uq6

Details for d1ezvy_

PDB Entry: 1ezv (more details), 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
PDB Compounds: (Y:) light chain (vl) of fv-fragment

SCOP Domain Sequences for d1ezvy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezvy_ b.1.1.1 (Y:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
dieltqtpvslaaslgdrvtiscrasqdinnflnwyqqkpdgtiklliyytsrlhagvps
rfsgsgsgtdysltisnlepediatyfcqhhikfpwtfgagtkleik

SCOP Domain Coordinates for d1ezvy_:

Click to download the PDB-style file with coordinates for d1ezvy_.
(The format of our PDB-style files is described here.)

Timeline for d1ezvy_: