Lineage for d1ezvi_ (1ezv I:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2578917Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 2578918Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 2578919Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
    interacts with cytochrome c1 and ISP
  7. 2578920Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81511] (4 PDB entries)
  8. 2578922Domain d1ezvi_: 1ezv I: [59553]
    Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvc2, d1ezvc3, d1ezvd1, d1ezvd2, d1ezve1, d1ezve2, d1ezvf_, d1ezvg_, d1ezvh_, d1ezvx_, d1ezvy_
    complexed with fes, hem, sma, uq6

Details for d1ezvi_

PDB Entry: 1ezv (more details), 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
PDB Compounds: (I:) ubiquinol-cytochrome c reductase complex 7.3 kd protein

SCOPe Domain Sequences for d1ezvi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezvi_ f.23.14.1 (I:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa

SCOPe Domain Coordinates for d1ezvi_:

Click to download the PDB-style file with coordinates for d1ezvi_.
(The format of our PDB-style files is described here.)

Timeline for d1ezvi_: