SCOP 1.61: Domain d1ezvh1: 1ezv H:

Lineage for d1ezvh1 (1ezv H:)

1. Root: SCOP 1.61

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (13 families)

5. Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein)

6. Protein Cytochrome bc1 transmembrane subunits [56907] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64530] (2 PDB entries)

8. Domain d1ezvh1: 1ezv H: [59552]
   Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvd1, d1ezve1, d1ezvx_, d1ezvy_

Details for d1ezvh1

PDB Entry: 1ezv, 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment

SCOP Domain Sequences for d1ezvh1:

Sequence; same for both SEQRES and ATOM records:

>d1ezvh1 f.2.1.8 (H:) Cytochrome bc1 transmembrane subunits {Baker's yeast (Saccharomyces cerevisiae)}
vtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqhy
ldtataprlfdklk

Timeline for d1ezvh1:

• d1ezvh1 first appeared in SCOP 1.57
  
• d1ezvh1 appears in SCOP 1.59
  
• d1ezvh1 is called d1ezvh_ in SCOP 1.63
  
• d1ezvh1 appears in the current release, SCOPe 2.08, called d1ezvh_