![]() | Class f: Membrane and cell surface proteins and peptides [56835] (42 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
![]() | Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) ![]() |
![]() | Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein) |
![]() | Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species) together with cytochrome b binds to ubiquinone |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81505] (4 PDB entries) |
![]() | Domain d1ezvg_: 1ezv G: [59551] Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvc2, d1ezvc3, d1ezvd1, d1ezvd2, d1ezve1, d1ezve2, d1ezvf_, d1ezvh_, d1ezvi_, d1ezvx_, d1ezvy_ complexed with fes, hem, sma, uq6 |
PDB Entry: 1ezv (more details), 2.3 Å
SCOP Domain Sequences for d1ezvg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ezvg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae)} gppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvli pagiywywwkngneyneflyskagreelervnv
Timeline for d1ezvg_: