| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
| Family d.185.1.1: MPP-like [63412] (7 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
| Protein Cytochrome bc1 core subunit 1 [63408] (3 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64304] (7 PDB entries) |
| Domain d1ezva1: 1ezv A:27-239 [59541] Other proteins in same PDB: d1ezvb1, d1ezvb2, d1ezvc2, d1ezvc3, d1ezvd1, d1ezvd2, d1ezve1, d1ezve2, d1ezvf_, d1ezvg_, d1ezvh_, d1ezvi_, d1ezvx_, d1ezvy_ complexed with fes, hem, sma, uq6 |
PDB Entry: 1ezv (more details), 2.3 Å
SCOPe Domain Sequences for d1ezva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ezva1 d.185.1.1 (A:27-239) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aevtqlsngivvatehnpahtasvgvvfgsgaanenpynngvsnlwkniflskensavaa
keglalssnisrdfqsyivsslpgstdksldflnqsfiqqkanllsssnfeatkksvlkq
vqdfedndhpnrvlehlhstafqntplslptrgtleslenlvvadlesfannhflnsnav
vvgtgnikhedlvnsiesknlslqtgtkpvlkk
Timeline for d1ezva1: