Lineage for d1ezva1 (1ezv A:27-239)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139995Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
  4. 139996Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
  5. 139997Family d.185.1.1: MPP-like [63412] (4 proteins)
  6. 139998Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 139999Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64304] (1 PDB entry)
  8. 140000Domain d1ezva1: 1ezv A:27-239 [59541]
    Other proteins in same PDB: d1ezvb1, d1ezvb2, d1ezvc1, d1ezvd1, d1ezvd2, d1ezve1, d1ezve2, d1ezvf1, d1ezvg1, d1ezvh1, d1ezvi1, d1ezvx_, d1ezvy_

Details for d1ezva1

PDB Entry: 1ezv (more details), 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment

SCOP Domain Sequences for d1ezva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezva1 d.185.1.1 (A:27-239) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae)}
aevtqlsngivvatehnpahtasvgvvfgsgaanenpynngvsnlwkniflskensavaa
keglalssnisrdfqsyivsslpgstdksldflnqsfiqqkanllsssnfeatkksvlkq
vqdfedndhpnrvlehlhstafqntplslptrgtleslenlvvadlesfannhflnsnav
vvgtgnikhedlvnsiesknlslqtgtkpvlkk

SCOP Domain Coordinates for d1ezva1:

Click to download the PDB-style file with coordinates for d1ezva1.
(The format of our PDB-style files is described here.)

Timeline for d1ezva1: