SCOP 1.71: Domain d1euzf2: 1euz F:3-180

Lineage for d1euzf2 (1euz F:3-180)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)

5. Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
   dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet

6. Protein Glutamate dehydrogenase [53225] (8 species)

7. Species Archaeon Thermococcus profundus [TaxId:49899] [64106] (1 PDB entry)

8. Domain d1euzf2: 1euz F:3-180 [59524]
   Other proteins in same PDB: d1euza1, d1euzb1, d1euzc1, d1euzd1, d1euze1, d1euzf1
   complexed with so4

Details for d1euzf2

PDB Entry: 1euz, 2.25 Å

PDB Description: glutamate dehydrogenase from thermococcus profundus in the unligated state

SCOP Domain Sequences for d1euzf2:

Sequence; same for both SEQRES and ATOM records:

>d1euzf2 c.58.1.1 (F:3-180) Glutamate dehydrogenase {Archaeon Thermococcus profundus}
eidpfemavkqleraaqymdiseealewlkkpmrivevsvpiemddgsvkvftgfrvqhn
wargptkggirwhpaetlstvkalatwmtwkvavvdlpygggkggiivnpkelsereqer
larayiravydvigpwtdipapdvytnpkimgwmmdeyetimrrkgpafgvitgkpls

Timeline for d1euzf2:

• d1euzf2 first appeared in SCOP 1.57
  
• d1euzf2 appears in SCOP 1.69
  
• d1euzf2 appears in SCOP 1.73
  
• d1euzf2 appears in the current release, SCOPe 2.08