Lineage for d1euze2 (1euz E:4-180)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 398612Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 398613Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 398614Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 398615Protein Glutamate dehydrogenase [53225] (7 species)
  7. 398627Species Archaeon Thermococcus profundus [TaxId:49899] [64106] (1 PDB entry)
  8. 398632Domain d1euze2: 1euz E:4-180 [59522]
    Other proteins in same PDB: d1euza1, d1euzb1, d1euzc1, d1euzd1, d1euze1, d1euzf1

Details for d1euze2

PDB Entry: 1euz (more details), 2.25 Å

PDB Description: glutamate dehydrogenase from thermococcus profundus in the unligated state

SCOP Domain Sequences for d1euze2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euze2 c.58.1.1 (E:4-180) Glutamate dehydrogenase {Archaeon Thermococcus profundus}
idpfemavkqleraaqymdiseealewlkkpmrivevsvpiemddgsvkvftgfrvqhnw
argptkggirwhpaetlstvkalatwmtwkvavvdlpygggkggiivnpkelsereqerl
arayiravydvigpwtdipapdvytnpkimgwmmdeyetimrrkgpafgvitgkpls

SCOP Domain Coordinates for d1euze2:

Click to download the PDB-style file with coordinates for d1euze2.
(The format of our PDB-style files is described here.)

Timeline for d1euze2: