Lineage for d1euza2 (1euz A:4-180)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72517Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
  4. 72518Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) (S)
  5. 72519Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
  6. 72520Protein Glutamate dehydrogenase [53225] (6 species)
  7. 72532Species Archaeon Thermococcus profundus [TaxId:49899] [64106] (1 PDB entry)
  8. 72533Domain d1euza2: 1euz A:4-180 [59514]
    Other proteins in same PDB: d1euza1, d1euzb1, d1euzc1, d1euzd1, d1euze1, d1euzf1

Details for d1euza2

PDB Entry: 1euz (more details), 2.25 Å

PDB Description: glutamate dehydrogenase from thermococcus profundus in the unligated state

SCOP Domain Sequences for d1euza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euza2 c.58.1.1 (A:4-180) Glutamate dehydrogenase {Archaeon Thermococcus profundus}
idpfemavkqleraaqymdiseealewlkkpmrivevsvpiemddgsvkvftgfrvqhnw
argptkggirwhpaetlstvkalatwmtwkvavvdlpygggkggiivnpkelsereqerl
arayiravydvigpwtdipapdvytnpkimgwmmdeyetimrrkgpafgvitgkpls

SCOP Domain Coordinates for d1euza2:

Click to download the PDB-style file with coordinates for d1euza2.
(The format of our PDB-style files is described here.)

Timeline for d1euza2: