Lineage for d1euza1 (1euz A:181-419)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66936Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins)
  6. 66937Protein Glutamate dehydrogenase [51884] (6 species)
  7. 66949Species Archaeon Thermococcus profundus [TaxId:49899] [63943] (1 PDB entry)
  8. 66950Domain d1euza1: 1euz A:181-419 [59513]
    Other proteins in same PDB: d1euza2, d1euzb2, d1euzc2, d1euzd2, d1euze2, d1euzf2

Details for d1euza1

PDB Entry: 1euz (more details), 2.25 Å

PDB Description: glutamate dehydrogenase from thermococcus profundus in the unligated state

SCOP Domain Sequences for d1euza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euza1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Thermococcus profundus}
iggslgrgtataqgaiftireaakalgidlkgkkiavqgygnagyytaklakeqlgmtvv
avsdsrggiynpdgldpdevlkwkrehgsvkdfpgatnitneellelevdvlapaaieev
iteknadnikakivaevangpvtpeaddilrekgilqipdflcnaggvtvsyfewvqnin
gyywteeevrekldkkmtkafwevynthkdknihmrdaayvvavsrvyqamkdrgwvkk

SCOP Domain Coordinates for d1euza1:

Click to download the PDB-style file with coordinates for d1euza1.
(The format of our PDB-style files is described here.)

Timeline for d1euza1: