Lineage for d1eumf_ (1eum F:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536008Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 536009Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 536010Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 536351Protein Non-hem ferritin [63524] (3 species)
  7. 536354Species Escherichia coli, FtnA [TaxId:562] [63525] (1 PDB entry)
  8. 536360Domain d1eumf_: 1eum F: [59512]

Details for d1eumf_

PDB Entry: 1eum (more details), 2.05 Å

PDB Description: crystal structure of the e.coli ferritin ecftna

SCOP Domain Sequences for d1eumf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eumf_ a.25.1.1 (F:) Non-hem ferritin {Escherichia coli, FtnA}
lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
wyvseqheeeklfksiidklslagksgeglyfidkelstld

SCOP Domain Coordinates for d1eumf_:

Click to download the PDB-style file with coordinates for d1eumf_.
(The format of our PDB-style files is described here.)

Timeline for d1eumf_: